Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Matrin 3 [143306] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143307] (2 PDB entries) Uniprot Q8K310 390-478! Uniprot Q8K310 478-576 |
Domain d1x4fa1: 1x4f A:8-106 [121688] 2nd RBD |
PDB Entry: 1x4f (more details)
SCOP Domain Sequences for d1x4fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} kkpegkpdqkfdqkqelgrvihlsnlphsgysdsavlklaepygkiknyilmrmksqafi emetredamamvdhclkkalwfqgrcvkvdlsekykklv
Timeline for d1x4fa1: