SCOP 1.75: Domain d1x3zb1: 1x3z B:253-309

Lineage for d1x3zb1 (1x3z B:253-309)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.189: XPC-binding domain [101237] (1 superfamily)
   4 helices; array

4. Superfamily a.189.1: XPC-binding domain [101238] (1 family)

5. Family a.189.1.1: XPC-binding domain [101239] (3 proteins)

6. Protein Rad23 STI1 domain [140601] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140602] (2 PDB entries)
   Uniprot P32628 253-309

8. Domain d1x3zb1: 1x3z B:253-309 [121674]
   Other proteins in same PDB: d1x3za1
   automatically matched to 1X3W B:253-309
   complexed with suc, zn

Details for d1x3zb1

PDB Entry: 1x3z, 2.8 Å

PDB Description: structure of a peptide:n-glycanase-rad23 complex

PDB Compounds: (B:) UV excision repair protein RAD23

SCOP Domain Sequences for d1x3zb1:

Sequence; same for both SEQRES and ATOM records:

>d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsigltvedllslrqvvsgnpealapllenisarypqlrehimanpevfvsmlleav

Timeline for d1x3zb1:

• d1x3zb1 first appeared in SCOP 1.73
  
• d1x3zb1 is called d1x3zb_ in SCOPe 2.01
  
• d1x3zb1 appears in the current release, SCOPe 2.08, called d1x3zb_