Lineage for d1x2ib_ (1x2i B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 916930Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 916973Family a.60.2.5: Hef domain-like [140629] (3 proteins)
    helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
  6. 916974Protein ATP-dependent RNA helicase PF2015 [140632] (1 species)
  7. 916975Species Pyrococcus furiosus [TaxId:2261] [140633] (1 PDB entry)
    Uniprot Q8TZH8 694-761
  8. 916977Domain d1x2ib_: 1x2i B: [121642]
    automated match to d1x2ia1

Details for d1x2ib_

PDB Entry: 1x2i (more details), 1.45 Å

PDB Description: Crystal Structure Of Archaeal Xpf/Mus81 Homolog, Hef From Pyrococcus Furiosus, Helix-hairpin-helix Domain
PDB Compounds: (B:) Hef helicase/nuclease

SCOPe Domain Sequences for d1x2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ib_ a.60.2.5 (B:) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}
altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr
vitapyie

SCOPe Domain Coordinates for d1x2ib_:

Click to download the PDB-style file with coordinates for d1x2ib_.
(The format of our PDB-style files is described here.)

Timeline for d1x2ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x2ia1