SCOP 1.75: Domain d1x2ib1: 1x2i B:2-69

Lineage for d1x2ib1 (1x2i B:2-69)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.5: Hef domain-like [140629] (3 proteins)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)

6. Protein ATP-dependent RNA helicase PF2015 [140632] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [140633] (1 PDB entry)
   Uniprot Q8TZH8 694-761

8. Domain d1x2ib1: 1x2i B:2-69 [121642]
   automatically matched to 1X2I A:2-69

Details for d1x2ib1

PDB Entry: 1x2i, 1.45 Å

PDB Description: Crystal Structure Of Archaeal Xpf/Mus81 Homolog, Hef From Pyrococcus Furiosus, Helix-hairpin-helix Domain

PDB Compounds: (B:) Hef helicase/nuclease

SCOP Domain Sequences for d1x2ib1:

Sequence; same for both SEQRES and ATOM records:

>d1x2ib1 a.60.2.5 (B:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}
altlaerqrliveglphvsatlarrllkhfgsvervftasvaelmkvegigekiakeirr
vitapyie

Timeline for d1x2ib1:

• d1x2ib1 first appeared in SCOP 1.73
  
• d1x2ib1 is called d1x2ib_ in SCOPe 2.01
  
• d1x2ib1 appears in the current release, SCOPe 2.08, called d1x2ib_