SCOPe 2.06: Domain d1x27d1: 1x27 D:64-118

Lineage for d1x27d1 (1x27 D:64-118)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50077] (5 PDB entries)

8. Domain d1x27d1: 1x27 D:64-118 [121627]
   Other proteins in same PDB: d1x27a2, d1x27b2, d1x27b3, d1x27c2, d1x27c3, d1x27d2, d1x27e2, d1x27f2
   automatically matched to d1h92a_
   complexed with na

Details for d1x27d1

PDB Entry: 1x27, 2.7 Å

PDB Description: Crystal Structure of Lck SH2-SH3 with SH2 binding site of p130Cas

PDB Compounds: (D:) Proto-oncogene tyrosine-protein kinase LCK

SCOPe Domain Sequences for d1x27d1:

Sequence; same for both SEQRES and ATOM records:

>d1x27d1 b.34.2.1 (D:64-118) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvak

Timeline for d1x27d1:

• d1x27d1 first appeared in SCOP 1.73
  
• d1x27d1 appears in SCOPe 2.05
  
• d1x27d1 appears in SCOPe 2.07
  
• d1x27d1 appears in the current release, SCOPe 2.08