Lineage for d1x23d_ (1x23 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1198735Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1198736Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1198737Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1198890Protein automated matches [190124] (11 species)
    not a true protein
  7. 1198898Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)
  8. 1198903Domain d1x23d_: 1x23 D: [121618]
    Other proteins in same PDB: d1x23a1
    automated match to d1ur6a_

Details for d1x23d_

PDB Entry: 1x23 (more details), 1.85 Å

PDB Description: Crystal structure of ubch5c
PDB Compounds: (D:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d1x23d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x23d_ d.20.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plgspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvfflt
ihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdp
npddplvpeiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d1x23d_:

Click to download the PDB-style file with coordinates for d1x23d_.
(The format of our PDB-style files is described here.)

Timeline for d1x23d_: