SCOPe 2.05: Domain d1x23b_: 1x23 B:

Lineage for d1x23b_ (1x23 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (39 PDB entries)

8. Domain d1x23b_: 1x23 B: [121616]
   Other proteins in same PDB: d1x23a1
   automated match to d1ur6a_

Details for d1x23b_

PDB Entry: 1x23, 1.85 Å

PDB Description: Crystal structure of ubch5c

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d1x23b_:

Sequence; same for both SEQRES and ATOM records:

>d1x23b_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gspefmalkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltih
fptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnp
ddplvpeiariyktdrdkynrisrewtqkyam

Timeline for d1x23b_:

• d1x23b_ first appeared in SCOP 1.73, called d1x23b1
  
• d1x23b_ appears in SCOPe 2.04
  
• d1x23b_ is called d1x23b2 in SCOPe 2.06
  
• d1x23b_ appears in the current release, SCOPe 2.08, called d1x23b2