SCOPe 2.08: Domain d1x23a1: 1x23 A:1-147

Lineage for d1x23a1 (1x23 A:1-147)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
Superfamily d.20.1: UBC-like [54495] (5 families)
Family d.20.1.1: UBC-related [54496] (7 proteins)
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
Species Human (Homo sapiens), E2 D3 [TaxId:9606] [143054] (3 PDB entries)
Uniprot P61077 1-147
Domain d1x23a1: 1x23 A:1-147 [121615]
Other proteins in same PDB: d1x23a2, d1x23b2, d1x23b3, d1x23c2, d1x23c3, d1x23d2, d1x23d3

Details for d1x23a1

PDB Entry: 1x23 (more details), 1.85 Å

PDB Description: Crystal structure of ubch5c

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d1x23a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x23a1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 D3 [TaxId: 9606]}
malkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrdkynrisrewtqkyam

SCOPe Domain Coordinates for d1x23a1:

Click to download the PDB-style file with coordinates for d1x23a1.
(The format of our PDB-style files is described here.)

Timeline for d1x23a1: