Lineage for d1x1sa_ (1x1s A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128907Species Mouse (Mus musculus) [TaxId:10090] [186847] (10 PDB entries)
  8. 2128911Domain d1x1sa_: 1x1s A: [121596]
    automated match to d1agp__
    complexed with gnp, mg

Details for d1x1sa_

PDB Entry: 1x1s (more details), 2.2 Å

PDB Description: Crystal structure of M-Ras in complex with GppNHp
PDB Compounds: (A:) Ras-related protein M-Ras

SCOPe Domain Sequences for d1x1sa_:

Sequence, based on SEQRES records: (download)

>d1x1sa_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldtag
qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

Sequence, based on observed residues (ATOM records): (download)

>d1x1sa_ c.37.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvpdydptiedsylkhteidnqwaildvldtfs
amreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdlmhlrk
vtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

SCOPe Domain Coordinates for d1x1sa_:

Click to download the PDB-style file with coordinates for d1x1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1x1sa_: