Lineage for d1x1ia2 (1x1i A:660-777)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662946Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 662947Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 662948Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 662991Protein Xanthan lyase [89264] (1 species)
  7. 662992Species Bacillus sp. gl1 [TaxId:84635] [89265] (7 PDB entries)
  8. 662993Domain d1x1ia2: 1x1i A:660-777 [121585]
    Other proteins in same PDB: d1x1ia1, d1x1ia3
    automatically matched to d1j0ma2
    complexed with 46m; mutant

Details for d1x1ia2

PDB Entry: 1x1i (more details), 1.8 Å

PDB Description: crystal structure of xanthan lyase (n194a) complexed with a product
PDB Compounds: (A:) xanthan lyase

SCOP Domain Sequences for d1x1ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ia2 b.24.1.1 (A:660-777) Xanthan lyase {Bacillus sp. gl1 [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOP Domain Coordinates for d1x1ia2:

Click to download the PDB-style file with coordinates for d1x1ia2.
(The format of our PDB-style files is described here.)

Timeline for d1x1ia2: