Lineage for d1x1ha2 (1x1h A:660-777)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779585Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 1779586Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 1779634Family b.24.1.0: automated matches [254204] (1 protein)
    not a true family
  6. 1779635Protein automated matches [254449] (1 species)
    not a true protein
  7. 1779636Species Bacillus sp. [TaxId:84635] [254960] (5 PDB entries)
  8. 1779641Domain d1x1ha2: 1x1h A:660-777 [121582]
    Other proteins in same PDB: d1x1ha1, d1x1ha3
    automated match to d1x1ia2

Details for d1x1ha2

PDB Entry: 1x1h (more details), 2.3 Å

PDB Description: crystal structure of xanthan lyase (n194a)
PDB Compounds: (A:) xanthan lyase

SCOPe Domain Sequences for d1x1ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ha2 b.24.1.0 (A:660-777) automated matches {Bacillus sp. [TaxId: 84635]}
paieivvntsgvqsvkektlglvganfwtdttqtadlitsnkkasvmtreiaderleasv
sdptqanngtiaielarsaegysadpgitvtqlaptikftvnvngakgksfhasfqlg

SCOPe Domain Coordinates for d1x1ha2:

Click to download the PDB-style file with coordinates for d1x1ha2.
(The format of our PDB-style files is described here.)

Timeline for d1x1ha2: