Lineage for d1x18f1 (1x18 F:2-156)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740240Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 1740241Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 1740242Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 1740243Protein Ribosomal protein S7 [47975] (4 species)
  7. 1740273Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 1740318Domain d1x18f1: 1x18 F:2-156 [121574]
    Other proteins in same PDB: d1x18e1, d1x18g1, d1x18h1, d1x18x1, d1x18x2
    automatically matched to d1fjgg_
    protein/RNA complex

Details for d1x18f1

PDB Entry: 1x18 (more details), 13.5 Å

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit
PDB Compounds: (F:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1x18f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x18f1 a.75.1.1 (F:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsrrqqslalrwlvqaanqrperraavriah
elmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1x18f1:

Click to download the PDB-style file with coordinates for d1x18f1.
(The format of our PDB-style files is described here.)

Timeline for d1x18f1: