SCOPe 2.02: Domain d1x18f1: 1x18 F:2-156

Lineage for d1x18f1 (1x18 F:2-156)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
   Uniprot P17291

8. Domain d1x18f1: 1x18 F:2-156 [121574]
   Other proteins in same PDB: d1x18e1, d1x18g1, d1x18h1, d1x18x1, d1x18x2
   automatically matched to d1fjgg_
   protein/RNA complex

Details for d1x18f1

PDB Entry: 1x18, 13.5 Å

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit

PDB Compounds: (F:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1x18f1:

Sequence; same for both SEQRES and ATOM records:

>d1x18f1 a.75.1.1 (F:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsrrqqslalrwlvqaanqrperraavriah
elmdaaegkggavkkkedvermaeanrayahyrw

Timeline for d1x18f1:

• d1x18f1 first appeared in SCOP 1.73
  
• d1x18f1 appears in SCOPe 2.01
  
• d1x18f1 appears in SCOPe 2.03
  
• d1x18f1 appears in the current release, SCOPe 2.08