![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries) Uniprot P80371 |
![]() | Domain d1x18e1: 1x18 E:7-240 [121573] Other proteins in same PDB: d1x18f1, d1x18g1, d1x18h1, d1x18x1, d1x18x2 automatically matched to d1i94b_ protein/RNA complex |
PDB Entry: 1x18 (more details), 13.5 Å
SCOPe Domain Sequences for d1x18e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x18e1 c.23.15.1 (E:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktiqrvhrleelealfaspei eerpkkeqrlhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialad tdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d1x18e1: