Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (34 proteins) Pfam PF00017 |
Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries) |
Domain d1x0na1: 1x0n A:60-159 [121551] automatically matched to d1fhs__ complexed with dtf |
PDB Entry: 1x0n (more details)
SCOP Domain Sequences for d1x0na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x0na1 d.93.1.1 (A:60-159) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} wffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagkyf lwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt
Timeline for d1x0na1: