SCOP 1.75: Domain d1x0na1: 1x0n A:60-159

Lineage for d1x0na1 (1x0n A:60-159)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (34 proteins)
   Pfam PF00017

6. Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55564] (20 PDB entries)

8. Domain d1x0na1: 1x0n A:60-159 [121551]
   automatically matched to d1fhs__
   complexed with dtf

Details for d1x0na1

PDB Entry: 1x0n

PDB Description: nmr structure of growth factor receptor binding protein sh2 domain complexed with the inhibitor

PDB Compounds: (A:) Growth factor receptor-bound protein 2

SCOP Domain Sequences for d1x0na1:

Sequence; same for both SEQRES and ATOM records:

>d1x0na1 d.93.1.1 (A:60-159) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
wffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdgagkyf
lwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt

Timeline for d1x0na1:

• d1x0na1 first appeared in SCOP 1.73
  
• d1x0na1 appears in SCOPe 2.01
  
• d1x0na1 appears in the current release, SCOPe 2.08, called d1x0na_