Lineage for d1wzvb_ (1wzv B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021860Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1021861Protein automated matches [190120] (3 species)
    not a true protein
  7. 1021864Species Human (Homo sapiens) [TaxId:9606] [186843] (3 PDB entries)
  8. 1021866Domain d1wzvb_: 1wzv B: [121530]
    Other proteins in same PDB: d1wzva1
    automated match to d1c4zd_

Details for d1wzvb_

PDB Entry: 1wzv (more details), 2.1 Å

PDB Description: Crystal Structure of UbcH8
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 L6

SCOPe Domain Sequences for d1wzvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzvb_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asmrvvkeledlqkkpppylrnlssddanvlvwhalllpdqppyhlkafnlrisfppeyp
fkppmikfttkiyhpnvdengqiclpiissenwkpctktcqvlealnvlvnrpnireplr
mdladlltqnpelfrknaeeftlrfgvdrp

SCOPe Domain Coordinates for d1wzvb_:

Click to download the PDB-style file with coordinates for d1wzvb_.
(The format of our PDB-style files is described here.)

Timeline for d1wzvb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wzva1