SCOP 1.75: Domain d1wzla2: 1wzl A:503-585

Lineage for d1wzla2 (1wzl A:503-585)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (16 PDB entries)

8. Domain d1wzla2: 1wzl A:503-585 [121514]
   Other proteins in same PDB: d1wzla1, d1wzla3, d1wzlb1, d1wzlb3
   automatically matched to d1bvza2
   complexed with ca; mutant

Details for d1wzla2

PDB Entry: 1wzl, 2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) mutatnt r469l

PDB Compounds: (A:) alpha-amylase II

SCOP Domain Sequences for d1wzla2:

Sequence; same for both SEQRES and ATOM records:

>d1wzla2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1wzla2:

• d1wzla2 first appeared in SCOP 1.73
  
• d1wzla2 appears in SCOPe 2.01
  
• d1wzla2 appears in the current release, SCOPe 2.08