![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (55 species) not a true protein |
![]() | Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (6 PDB entries) |
![]() | Domain d1wzla1: 1wzl A:1-120 [121513] Other proteins in same PDB: d1wzla2, d1wzla3, d1wzlb2, d1wzlb3 automated match to d1wzla1 complexed with ca |
PDB Entry: 1wzl (more details), 2 Å
SCOPe Domain Sequences for d1wzla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzla1 b.1.18.0 (A:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
Timeline for d1wzla1: