SCOP 1.73: Domain d1wzeb2: 1wze B:154-332

Lineage for d1wzeb2 (1wze B:154-332)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Thermus thermophilus [TaxId:274] [82806] (5 PDB entries)
   identical sequence to that from the Thermus flavus enzyme

8. Domain d1wzeb2: 1wze B:154-332 [121498]
   Other proteins in same PDB: d1wzea1, d1wzeb1
   automatically matched to d1iz9a2
   complexed with nad; mutant

Details for d1wzeb2

PDB Entry: 1wze, 2 Å

PDB Description: structural basis for alteration of cofactor specificity of malate dehydrogenase from thermus flavus

PDB Compounds: (B:) malate dehydrogenase

SCOP Domain Sequences for d1wzeb2:

Sequence; same for both SEQRES and ATOM records:

>d1wzeb2 d.162.1.1 (B:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]}
mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy
ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi
pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

Timeline for d1wzeb2:

• d1wzeb2 is new in SCOP 1.73
  
• d1wzeb2 appears in SCOP 1.75
  
• d1wzeb2 appears in the current release, SCOPe 2.08