SCOPe 2.06: Domain d1wzdb_: 1wzd B:

Lineage for d1wzdb_ (1wzd B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
   automatically mapped to Pfam PF01126

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
   Uniprot P71119

8. Domain d1wzdb_: 1wzd B: [121494]
   automated match to d1iw1a_
   complexed with gol, so4, yok

Details for d1wzdb_

PDB Entry: 1wzd, 1.35 Å

PDB Description: crystal structure of an artificial metalloprotein: fe(10-ch2ch2cooh-salophen)/wild type heme oxygenase

PDB Compounds: (B:) Heme oxygenase

SCOPe Domain Sequences for d1wzdb_:

Sequence; same for both SEQRES and ATOM records:

>d1wzdb_ a.132.1.1 (B:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d1wzdb_:

• d1wzdb_ first appeared in SCOP 1.73, called d1wzdb1
  
• d1wzdb_ appears in SCOPe 2.05
  
• d1wzdb_ appears in SCOPe 2.07
  
• d1wzdb_ appears in the current release, SCOPe 2.08