SCOP 1.75: Domain d1wzdb1: 1wzd B:7-213

Lineage for d1wzdb1 (1wzd B:7-213)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (10 PDB entries)
   Uniprot P71119

8. Domain d1wzdb1: 1wzd B:7-213 [121494]
   automatically matched to d1iw1a_
   complexed with gol, so4, yok

Details for d1wzdb1

PDB Entry: 1wzd, 1.35 Å

PDB Description: crystal structure of an artificial metalloprotein: fe(10-ch2ch2cooh-salophen)/wild type heme oxygenase

PDB Compounds: (B:) Heme oxygenase

SCOP Domain Sequences for d1wzdb1:

Sequence; same for both SEQRES and ATOM records:

>d1wzdb1 a.132.1.1 (B:7-213) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgk

Timeline for d1wzdb1:

• d1wzdb1 first appeared in SCOP 1.73
  
• d1wzdb1 is called d1wzdb_ in SCOPe 2.01
  
• d1wzdb1 appears in the current release, SCOPe 2.08, called d1wzdb_