Lineage for d1wz3b_ (1wz3 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018282Family d.15.1.7: APG12-like [142972] (2 proteins)
    Pfam PF04110
  6. 1018286Protein automated matches [190819] (1 species)
    not a true protein
  7. 1018287Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188103] (1 PDB entry)
  8. 1018288Domain d1wz3b_: 1wz3 B: [121479]
    Other proteins in same PDB: d1wz3a1
    automated match to d1wz3a1

Details for d1wz3b_

PDB Entry: 1wz3 (more details), 1.8 Å

PDB Description: the crystal structure of plant atg12
PDB Compounds: (B:) autophagy 12b

SCOPe Domain Sequences for d1wz3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz3b_ d.15.1.7 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes
vidlynnfgfdgklvvnyacsmaw

SCOPe Domain Coordinates for d1wz3b_:

Click to download the PDB-style file with coordinates for d1wz3b_.
(The format of our PDB-style files is described here.)

Timeline for d1wz3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wz3a1