Lineage for d1wz3b1 (1wz3 B:10-93)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 854083Family d.15.1.7: APG12-like [142972] (1 protein)
    Pfam PF04110
  6. 854084Protein Autophagy-related protein 12b (APG12b) [142973] (1 species)
  7. 854085Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142974] (1 PDB entry)
    Uniprot Q9LVK3 10-93
  8. 854087Domain d1wz3b1: 1wz3 B:10-93 [121479]
    automatically matched to 1WZ3 A:10-93

Details for d1wz3b1

PDB Entry: 1wz3 (more details), 1.8 Å

PDB Description: the crystal structure of plant atg12
PDB Compounds: (B:) autophagy 12b

SCOP Domain Sequences for d1wz3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wz3b1 d.15.1.7 (B:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes
vidlynnfgfdgklvvnyacsmaw

SCOP Domain Coordinates for d1wz3b1:

Click to download the PDB-style file with coordinates for d1wz3b1.
(The format of our PDB-style files is described here.)

Timeline for d1wz3b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wz3a1