![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.7: APG12-like [142972] (2 proteins) Pfam PF04110 |
![]() | Protein Autophagy-related protein 12b (APG12b) [142973] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142974] (1 PDB entry) Uniprot Q9LVK3 10-93 |
![]() | Domain d1wz3a1: 1wz3 A:10-93 [121478] Other proteins in same PDB: d1wz3b_ segment-swapped dimer |
PDB Entry: 1wz3 (more details), 1.8 Å
SCOPe Domain Sequences for d1wz3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wz3a1 d.15.1.7 (A:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} qkivvhlratggapilkqskfkvsgsdkfanvidflrrqlhsdslfvyvnsafspnpdes vidlynnfgfdgklvvnyacsmaw
Timeline for d1wz3a1: