SCOPe 2.08: Domain d1wywb_: 1wyw B:

Lineage for d1wywb_ (1wyw B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)

8. Domain d1wywb_: 1wyw B: [121468]
   Other proteins in same PDB: d1wywa_
   automated match to d1a5r__
   complexed with cl, mg, na

Details for d1wywb_

PDB Entry: 1wyw, 2.1 Å

PDB Description: Crystal Structure of SUMO1-conjugated thymine DNA glycosylase

PDB Compounds: (B:) Ubiquitin-like protein SMT3C

SCOPe Domain Sequences for d1wywb_:

Sequence; same for both SEQRES and ATOM records:

>d1wywb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
geyiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpk
elgmeeedvievyqeqtgg

Timeline for d1wywb_:

• d1wywb_ first appeared in SCOP 1.73, called d1wywb1
  
• d1wywb_ appears in SCOPe 2.07