Lineage for d1wxva1 (1wxv A:8-86)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931211Protein Bag-family molecular chaperone regulator-1 [142932] (2 species)
  7. 2931212Species Human (Homo sapiens) [TaxId:9606] [142933] (1 PDB entry)
    Uniprot Q99933 72-152
    the BAG domain structure is also known (63494)
  8. 2931213Domain d1wxva1: 1wxv A:8-86 [121409]
    Other proteins in same PDB: d1wxva2, d1wxva3

Details for d1wxva1

PDB Entry: 1wxv (more details)

PDB Description: solution structure of the ubiquitin domain of bcl-2 binding athanogene-1
PDB Compounds: (A:) bag-family molecular chaperone regulator-1

SCOPe Domain Sequences for d1wxva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wxva1 d.15.1.1 (A:8-86) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]}
ltvtvthsnekhdlhvtsqqgssepvvqdlaqvveevigvpqsfqklifkgkslkemetp
lsalgiqdgcrvmligkkn

SCOPe Domain Coordinates for d1wxva1:

Click to download the PDB-style file with coordinates for d1wxva1.
(The format of our PDB-style files is described here.)

Timeline for d1wxva1: