Lineage for d1wx8a1 (1wx8 A:8-90)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853598Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 853605Protein 4931431F19Rik [142950] (1 species)
  7. 853606Species Mouse (Mus musculus) [TaxId:10090] [142951] (1 PDB entry)
    Uniprot Q9D4I8 14-96
    structure of the C-terminal UBA domain is also known (PDB 1vej)
  8. 853607Domain d1wx8a1: 1wx8 A:8-90 [121393]

Details for d1wx8a1

PDB Entry: 1wx8 (more details)

PDB Description: Solution Structure of the N-terminal Ubiquitin-like Domain in the 4931431F19Rik Protein
PDB Compounds: (A:) RIKEN cDNA 4931431F19

SCOP Domain Sequences for d1wx8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}
vsgrepssriirvsvktpqdchefflaensnvrrfkkqiskylhcnadrlvliftgkilr
dqdilsqrgildgstvhvvvrsh

SCOP Domain Coordinates for d1wx8a1:

Click to download the PDB-style file with coordinates for d1wx8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wx8a1: