Lineage for d1wvza_ (1wvz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754028Domain d1wvza_: 1wvz A: [121347]
    automated match to d3cafa_

Details for d1wvza_

PDB Entry: 1wvz (more details)

PDB Description: solution structure of the d2 domain of the fibroblast growth factor
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d1wvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvza_ b.1.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv

SCOPe Domain Coordinates for d1wvza_:

Click to download the PDB-style file with coordinates for d1wvza_.
(The format of our PDB-style files is described here.)

Timeline for d1wvza_: