SCOPe 2.06: Domain d1wvab_: 1wva B:

Lineage for d1wvab_ (1wva B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein automated matches [190112] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)

8. Domain d1wvab_: 1wva B: [121328]
   Other proteins in same PDB: d1wvaa1
   automated match to d1hqfa_
   complexed with mn, s2c

Details for d1wvab_

PDB Entry: 1wva, 1.94 Å

PDB Description: Crystal structure of human arginase I from twinned crystal

PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d1wvab_:

Sequence; same for both SEQRES and ATOM records:

>d1wvab_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhk

Timeline for d1wvab_:

• d1wvab_ first appeared in SCOP 1.73, called d1wvab1
  
• d1wvab_ appears in SCOPe 2.05
  
• d1wvab_ appears in SCOPe 2.07
  
• d1wvab_ appears in the current release, SCOPe 2.08