Lineage for d1wv7l2 (1wv7 L:87-142)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1459896Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1459897Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1459906Protein Coagulation factor VIIa [57201] (1 species)
  7. 1459907Species Human (Homo sapiens) [TaxId:9606] [57202] (43 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 1459961Domain d1wv7l2: 1wv7 L:87-142 [121322]
    Other proteins in same PDB: d1wv7h_, d1wv7l3, d1wv7t1, d1wv7t2
    automated match to d1danl2
    complexed with 5pi, bgc, ca, fuc

Details for d1wv7l2

PDB Entry: 1wv7 (more details), 2.7 Å

PDB Description: Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-5-propoxy-Trp-Gln-p-aminobenzamidine
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wv7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wv7l2 g.3.11.1 (L:87-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d1wv7l2:

Click to download the PDB-style file with coordinates for d1wv7l2.
(The format of our PDB-style files is described here.)

Timeline for d1wv7l2: