Lineage for d1wunl1 (1wun L:49-86)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031147Protein Coagulation factor VIIa [57201] (1 species)
  7. 3031148Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 3031221Domain d1wunl1: 1wun L:49-86 [121299]
    Other proteins in same PDB: d1wunh_, d1wunl3, d1wunt1, d1wunt2
    automated match to d1danl1
    complexed with bgc, ca, fuc, p5b

Details for d1wunl1

PDB Entry: 1wun (more details), 2.4 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-trp- gln-p-aminobenzamidine
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wunl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wunl1 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

SCOPe Domain Coordinates for d1wunl1:

Click to download the PDB-style file with coordinates for d1wunl1.
(The format of our PDB-style files is described here.)

Timeline for d1wunl1: