Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries) |
Domain d1wunh_: 1wun H: [121298] Other proteins in same PDB: d1wunl1, d1wunl2, d1wunl3, d1wunt1, d1wunt2 automated match to d1cvwh_ complexed with bgc, ca, fuc, p5b |
PDB Entry: 1wun (more details), 2.4 Å
SCOPe Domain Sequences for d1wunh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wunh_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d1wunh_: