SCOP 1.73: Domain d1wuma1: 1wum A:715-832

Lineage for d1wuma1 (1wum A:715-832)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (1 family)

5. Family a.29.2.1: Bromodomain [47371] (4 proteins)

6. Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47376] (5 PDB entries)

8. Domain d1wuma1: 1wum A:715-832 [121297]
   automatically matched to d1jm4b_
   complexed with np2

Details for d1wuma1

PDB Entry: 1wum

PDB Description: complex structure of pcaf bromodomain with small chemical ligand np2

PDB Compounds: (A:) Histone acetylatransferase PCAF

SCOP Domain Sequences for d1wuma1:

Sequence; same for both SEQRES and ATOM records:

>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

Timeline for d1wuma1:

• d1wuma1 is new in SCOP 1.73
  
• d1wuma1 appears in SCOP 1.75
  
• d1wuma1 appears in the current release, SCOPe 2.08, called d1wuma2