Lineage for d1wuga1 (1wug A:715-832)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639850Superfamily a.29.2: Bromodomain [47370] (1 family) (S)
  5. 639851Family a.29.2.1: Bromodomain [47371] (4 proteins)
  6. 639861Protein P300/CAF histone acetyltransferase bromodomain [47375] (1 species)
  7. 639862Species Human (Homo sapiens) [TaxId:9606] [47376] (5 PDB entries)
  8. 639865Domain d1wuga1: 1wug A:715-832 [121286]
    automatically matched to d1jm4b_
    complexed with np1

Details for d1wuga1

PDB Entry: 1wug (more details)

PDB Description: complex structure of pcaf bromodomain with small chemical ligand np1
PDB Compounds: (A:) Histone acetylatransferase PCAF

SCOP Domain Sequences for d1wuga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wuga1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]}
gshmskeprdpdqlystlksilqqvkshqsawpfmepvkrteapgyyevirfpmdlktms
erlknryyvskklfmadlqrvftnckeynppeseyykcanilekfffskikeaglidk

SCOP Domain Coordinates for d1wuga1:

Click to download the PDB-style file with coordinates for d1wuga1.
(The format of our PDB-style files is described here.)

Timeline for d1wuga1: