SCOP 1.75: Domain d1wtgl2: 1wtg L:91-140

Lineage for d1wtgl2 (1wtg L:91-140)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (22 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d1wtgl2: 1wtg L:91-140 [121264]
   Other proteins in same PDB: d1wtgh1, d1wtgl3, d1wtgt1, d1wtgt2
   automatically matched to d1pfxl2
   complexed with 3bp, bgc, ca, fuc

Details for d1wtgl2

PDB Entry: 1wtg, 2.2 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d- biphenylalanine-gln-p-aminobenzamidine

PDB Compounds: (L:) Coagulation factor VII

SCOP Domain Sequences for d1wtgl2:

Sequence; same for both SEQRES and ATOM records:

>d1wtgl2 g.3.11.1 (L:91-140) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
cvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipi

Timeline for d1wtgl2:

• d1wtgl2 first appeared in SCOP 1.73
  
• d1wtgl2 appears in SCOPe 2.01
  
• d1wtgl2 appears in the current release, SCOPe 2.08