Lineage for d1wt9b_ (1wt9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001736Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [88871] (3 PDB entries)
  8. 3001737Domain d1wt9b_: 1wt9 B: [121255]
    Other proteins in same PDB: d1wt9a1
    automated match to d1iodb_
    complexed with ca

Details for d1wt9b_

PDB Entry: 1wt9 (more details), 2.01 Å

PDB Description: crystal structure of Aa-X-bp-I, a snake venom protein with the activity of binding to coagulation factor X from Agkistrodon acutus
PDB Compounds: (B:) anticoagulant protein-B

SCOPe Domain Sequences for d1wt9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wt9b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

SCOPe Domain Coordinates for d1wt9b_:

Click to download the PDB-style file with coordinates for d1wt9b_.
(The format of our PDB-style files is described here.)

Timeline for d1wt9b_: