Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins) |
Domain d1wsud2: 1wsu D:575-634 [121252] automatically matched to d1lvaa4 protein/RNA complex |
PDB Entry: 1wsu (more details), 2.3 Å
SCOPe Domain Sequences for d1wsud2:
Sequence, based on SEQRES records: (download)
>d1wsud2 a.4.5.35 (D:575-634) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvgn
>d1wsud2 a.4.5.35 (D:575-634) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} qalgeareviknlagpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvvgn
Timeline for d1wsud2: