SCOP 1.73: Domain d1wsuc2: 1wsu C:575-632

Lineage for d1wsuc2 (1wsu C:575-632)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (1 protein)

6. Protein C-terminal fragment of elongation factor SelB [74684] (1 species)
   duplication: tandem repeat of four "winged helix" domains

7. Species Moorella thermoacetica [TaxId:1525] [74685] (3 PDB entries)

8. Domain d1wsuc2: 1wsu C:575-632 [121250]
   automatically matched to d1lvaa4

Details for d1wsuc2

PDB Entry: 1wsu, 2.3 Å

PDB Description: C-terminal domain of elongation factor selB complexed with SECIS RNA

PDB Compounds: (C:) Selenocysteine-specific elongation factor

SCOP Domain Sequences for d1wsuc2:

Sequence, based on SEQRES records:

>d1wsuc2 a.4.5.35 (C:575-632) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrrvgdkrvvv

Sequence, based on observed residues (ATOM records):

>d1wsuc2 a.4.5.35 (C:575-632) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]}
qalgeareviknlastgpfglaeardalgssrkyvlplleyldqvkftrkrvvv

Timeline for d1wsuc2:

• d1wsuc2 is new in SCOP 1.73
  
• d1wsuc2 appears in SCOP 1.75
  
• d1wsuc2 appears in the current release, SCOPe 2.08