Lineage for d1wsst2 (1wss T:109-209)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521240Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1521340Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 1521341Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
    Uniprot P13726 33-242
  8. 1521386Domain d1wsst2: 1wss T:109-209 [121243]
    Other proteins in same PDB: d1wssh_, d1wssl1, d1wssl2, d1wssl3
    automatically matched to d1a21a2
    complexed with 3cb, bgc, ca, fuc

Details for d1wsst2

PDB Entry: 1wss (more details), 2.6 Å

PDB Description: Human Factor Viia-Tissue Factor in Complex with peptide-mimetic inhibitor that has two charged groups in P2 and P4
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wsst2:

Sequence, based on SEQRES records: (download)

>d1wsst2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Sequence, based on observed residues (ATOM records): (download)

>d1wsst2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn
tneflidvdkgenycfsvqavipsrtvnrkstdspvec

SCOPe Domain Coordinates for d1wsst2:

Click to download the PDB-style file with coordinates for d1wsst2.
(The format of our PDB-style files is described here.)

Timeline for d1wsst2: