Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries) |
Domain d1wsst2: 1wss T:109-209 [121243] Other proteins in same PDB: d1wssh_, d1wssl1, d1wssl2, d1wssl3 automatically matched to d1a21a2 complexed with 3cb, bgc, ca, fuc |
PDB Entry: 1wss (more details), 2.6 Å
SCOPe Domain Sequences for d1wsst2:
Sequence, based on SEQRES records: (download)
>d1wsst2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec
>d1wsst2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn tneflidvdkgenycfsvqavipsrtvnrkstdspvec
Timeline for d1wsst2:
View in 3D Domains from other chains: (mouse over for more information) d1wssh_, d1wssl1, d1wssl2, d1wssl3 |