Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries) Uniprot P13726 33-242 |
Domain d1wqvt2: 1wqv T:109-209 [121178] Other proteins in same PDB: d1wqvh_, d1wqvl1, d1wqvl2, d1wqvl3 automatically matched to d1a21a2 complexed with bgc, ca, fuc, psm |
PDB Entry: 1wqv (more details), 2.5 Å
SCOPe Domain Sequences for d1wqvt2:
Sequence, based on SEQRES records: (download)
>d1wqvt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec
>d1wqvt2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn tneflidvdkgenycfsvqavipsrtvnrkstdspvec
Timeline for d1wqvt2:
View in 3D Domains from other chains: (mouse over for more information) d1wqvh_, d1wqvl1, d1wqvl2, d1wqvl3 |