SCOPe 2.01: Domain d1wqvl1: 1wqv L:46-82

Lineage for d1wqvl1 (1wqv L:46-82)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Factor IX (IXa) [57198] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)

8. Domain d1wqvl1: 1wqv L:46-82 [121174]
   Other proteins in same PDB: d1wqvh_, d1wqvl3, d1wqvt1, d1wqvt2
   automatically matched to d1pfxl1
   complexed with bgc, ca, fuc, psm

Details for d1wqvl1

PDB Entry: 1wqv, 2.5 Å

PDB Description: human factor viia-tissue factor complexed with propylsulfonamide-d- thr-met-p-aminobenzamidine

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d1wqvl1:

Sequence; same for both SEQRES and ATOM records:

>d1wqvl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

Timeline for d1wqvl1:

• d1wqvl1 first appeared in SCOP 1.73
  
• d1wqvl1 appears in SCOP 1.75
  
• d1wqvl1 appears in SCOPe 2.02
  
• d1wqvl1 appears in the current release, SCOPe 2.08