Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein automated matches [190044] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (136 PDB entries) |
Domain d1wqvh_: 1wqv H: [121173] Other proteins in same PDB: d1wqvl1, d1wqvl2, d1wqvl3, d1wqvt1, d1wqvt2 automated match to d1cvwh_ complexed with bgc, ca, fuc, psm |
PDB Entry: 1wqv (more details), 2.5 Å
SCOPe Domain Sequences for d1wqvh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wqvh_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
Timeline for d1wqvh_: