SCOP 1.75: Domain d1wqlb1: 1wql B:5-186

Lineage for d1wqlb1 (1wql B:5-186)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (30 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (6 proteins)
   Pfam PF00866

6. Protein Small subunit of cumene dioxygenase CumA2 [142997] (1 species)

7. Species Pseudomonas fluorescens [TaxId:294] [142998] (1 PDB entry)
   Uniprot Q51744 6-186

8. Domain d1wqlb1: 1wql B:5-186 [121172]
   Other proteins in same PDB: d1wqla1, d1wqla2
   complexed with fe2, fes, oxy

Details for d1wqlb1

PDB Entry: 1wql, 2.2 Å

PDB Description: Cumene dioxygenase (cumA1A2) from Pseudomonas fluorescens IP01

PDB Compounds: (B:) ethylbenzene dioxygenase small subunit

SCOP Domain Sequences for d1wqlb1:

Sequence; same for both SEQRES and ATOM records:

>d1wqlb1 d.17.4.4 (B:5-186) Small subunit of cumene dioxygenase CumA2 {Pseudomonas fluorescens [TaxId: 294]}
dltkpiewpempvslelqnaveqfyyreaqlldyqnyeawlalltqdiqywmpirtthts
rnkameyvppggnahfdetyesmrarirarvsglnwtedppsrsrhivsnvivretesag
tlevssaflcyrnrlermtdiyvgerrdillrvsdglgfkiakrtilldqstitannlsq
ff

Timeline for d1wqlb1:

• d1wqlb1 first appeared in SCOP 1.73
  
• d1wqlb1 appears in SCOPe 2.01
  
• d1wqlb1 appears in the current release, SCOPe 2.08