SCOPe 2.02: Domain d1wq2a_: 1wq2 A:

Lineage for d1wq2a_ (1wq2 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins)

6. Protein automated matches [190106] (1 species)
   not a true protein

7. Species Desulfovibrio vulgaris [TaxId:881] [186830] (1 PDB entry)

8. Domain d1wq2a_: 1wq2 A: [121161]
   automated match to d1ucrb_
   complexed with dod, so4

Details for d1wq2a_

PDB Entry: 1wq2, 2.4 Å

PDB Description: neutron crystal structure of dissimilatory sulfite reductase d (dsrd)

PDB Compounds: (A:) Protein dsvD

SCOPe Domain Sequences for d1wq2a_:

Sequence, based on SEQRES records:

>d1wq2a_ a.4.5.45 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst
tmyglkgagk

Sequence, based on observed residues (ATOM records):

>d1wq2a_ a.4.5.45 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]}
meeakqkvvdflnsskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttmygl
kgagk

Timeline for d1wq2a_:

• d1wq2a_ first appeared in SCOP 1.73, called d1wq2a1
  
• d1wq2a_ appears in SCOPe 2.01
  
• d1wq2a_ appears in SCOPe 2.03
  
• d1wq2a_ appears in the current release, SCOPe 2.08