Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.45: Dissimilatory sulfite reductase DsvD [101048] (2 proteins) automatically mapped to Pfam PF08679 |
Protein automated matches [190106] (1 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:881] [186830] (1 PDB entry) |
Domain d1wq2a_: 1wq2 A: [121161] automated match to d1ucrb_ complexed with dod, so4 |
PDB Entry: 1wq2 (more details), 2.4 Å
SCOPe Domain Sequences for d1wq2a_:
Sequence, based on SEQRES records: (download)
>d1wq2a_ a.4.5.45 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]} meeakqkvvdflnsksgskskfyfndftdlfpdmkqrevkkiltalvndevleywssgst tmyglkgagk
>d1wq2a_ a.4.5.45 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 881]} meeakqkvvdflnsskfyfndftdlfpdmkqrevkkiltalvndevleywssgsttmygl kgagk
Timeline for d1wq2a_: