Lineage for d1woxb_ (1wox B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. Protein automated matches [190372] (2 species)
    not a true protein
  7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [188085] (3 PDB entries)
  8. Domain d1woxb_: 1wox B: [121129]
    automated match to d1wova1
    complexed with hem, no

Details for d1woxb_

PDB Entry: 1wox (more details), 2.1 Å

PDB Description: Crystal structure of heme oxygenase-2 from Synechocystis sp. PCC 6803 in complex with heme and NO
PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d1woxb_:

Sequence, based on SEQRES records: (download)

>d1woxb_ a.132.1.1 (B:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearstag
hpitlmvge

Sequence, based on observed residues (ATOM records): (download)

>d1woxb_ a.132.1.1 (B:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
mvge

SCOPe Domain Coordinates for d1woxb_ are not available.

Timeline for d1woxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1woxa_