Lineage for d1woxa1 (1wox A:2-250)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777762Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 777763Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 777764Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 777765Protein Heme oxygenase 2 [140948] (1 species)
  7. 777766Species Synechocystis sp. pcc 6803 [TaxId:1148] [140949] (3 PDB entries)
    Uniprot P74133 2-250
  8. 777769Domain d1woxa1: 1wox A:2-250 [121128]
    automatically matched to 1WOV A:2-250
    complexed with hem, no

Details for d1woxa1

PDB Entry: 1wox (more details), 2.1 Å

PDB Description: Crystal structure of heme oxygenase-2 from Synechocystis sp. PCC 6803 in complex with heme and NO
PDB Compounds: (A:) Heme oxygenase 2

SCOP Domain Sequences for d1woxa1:

Sequence, based on SEQRES records: (download)

>d1woxa1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearstag
hpitlmvge

Sequence, based on observed residues (ATOM records): (download)

>d1woxa1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
mvge

SCOP Domain Coordinates for d1woxa1:

Click to download the PDB-style file with coordinates for d1woxa1.
(The format of our PDB-style files is described here.)

Timeline for d1woxa1: