Lineage for d1wova1 (1wov A:2-250)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. Protein Heme oxygenase 2 [140948] (1 species)
  7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [140949] (1 PDB entry)
    Uniprot P74133 2-250
  8. Domain d1wova1: 1wov A:2-250 [121124]
    Other proteins in same PDB: d1wovb_
    complexed with hem

Details for d1wova1

PDB Entry: 1wov (more details), 1.7500000000000002 Å

PDB Description: crystal structure of heme oxygenase-2 from synechocystis sp. pcc 6803 in complex with heme
PDB Compounds: (A:) Heme oxygenase 2

SCOPe Domain Sequences for d1wova1:

Sequence, based on SEQRES records: (download)

>d1wova1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearstag
hpitlmvge

Sequence, based on observed residues (ATOM records): (download)

>d1wova1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
mvge

SCOPe Domain Coordinates for d1wova1 are not available.

Timeline for d1wova1:

Domains from other chains:
(mouse over for more information)
d1wovb_