Lineage for d1wnob2 (1wno B:261-322)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720614Protein Chitinase 1 [54562] (2 species)
  7. 720615Species Aspergillus fumigatus [TaxId:5085] [117868] (9 PDB entries)
  8. 720633Domain d1wnob2: 1wno B:261-322 [121101]
    Other proteins in same PDB: d1wnoa1, d1wnob1
    automatically matched to 1WNO A:261-322
    complexed with mg, nag, ndg, so4

Details for d1wnob2

PDB Entry: 1wno (more details), 2.1 Å

PDB Description: Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407
PDB Compounds: (B:) chitinase

SCOP Domain Sequences for d1wnob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnob2 d.26.3.1 (B:261-322) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

SCOP Domain Coordinates for d1wnob2:

Click to download the PDB-style file with coordinates for d1wnob2.
(The format of our PDB-style files is described here.)

Timeline for d1wnob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wnob1